Recombinant Human KIF5C, His-tagged
Cat.No. : | KIF5C-28649TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 500-957 of Human Kinesin 5C, with N terminal His tag; MWt 55kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 500-957 a.a. |
Description : | Kinesins are a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types, and is subject to spatial and temporal regulation. These proteins have a modular structure including a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. They typically consist of two identical, approximately 110 to 120 kDa heavy chains, and two identical, approximately 60 to 70 kDa light chains.There are currently three known Kinesin 5 family members denoted as A, B, and C. Kinesin 5A and kinesin 5C appear to be exclusively neuronal, whereas kinesin 5B appears to be ubiquitous in its expression. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 57 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQEL SNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVN GVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDS NRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQK RRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRL QDAEEMKKALEQQMESHREAHQKQLSRLRDEIEEKQKI IDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEK LLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQ DLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLT KVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKE AKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIA KPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK |
Gene Name | KIF5C kinesin family member 5C [ Homo sapiens ] |
Official Symbol | KIF5C |
Synonyms | KIF5C; kinesin family member 5C; kinesin heavy chain isoform 5C; |
Gene ID | 3800 |
mRNA Refseq | NM_004522 |
Protein Refseq | NP_004513 |
MIM | 604593 |
Uniprot ID | O60282 |
Chromosome Location | 2q23 |
Pathway | Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; |
Function | ATP binding; apolipoprotein receptor binding; microtubule motor activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
SP4-001H | Recombinant Human SP4 Protein, GST-tagged | +Inquiry |
AFP-0004H | Recombinant Human AFP Protein | +Inquiry |
AP1B1-698R | Recombinant Rat AP1B1 Protein | +Inquiry |
PIK3CG-1345H | Recombinant Human PIK3CG protein, His&Myc-tagged | +Inquiry |
CIDEC-413H | Recombinant Human CIDEC Protein, GST-His-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC2D-737RCL | Recombinant Rat CLEC2D cell lysate | +Inquiry |
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
NPLOC4-3740HCL | Recombinant Human NPLOC4 293 Cell Lysate | +Inquiry |
Kidney-274H | Human Kidney Membrane Tumor Lysate | +Inquiry |
COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KIF5C Products
Required fields are marked with *
My Review for All KIF5C Products
Required fields are marked with *
0
Inquiry Basket