Recombinant Human KIF21A protein, GST-tagged

• Cat.No.: KIF21A-3717H
• Product Overview: Recombinant Human KIF21A protein(1125-1230 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1125-1230 aa
• AA Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KIF21A kinesin family member 21A [ Homo sapiens ]
• Official Symbol: KIF21A
• Synonyms: KIF21A; kinesin family member 21A; FEOM1, fibrosis of the extraocular muscles, congenital, 1; kinesin-like protein KIF21A; FLJ20052; kinesin-like protein KIF2; renal carcinoma antigen NY-REN-62; FEOM1; CFEOM1; FEOM3A; KIAA1708; DKFZp779C159
• Gene ID: 55605
• mRNA Refseq: NM_001173463
• Protein Refseq: NP_001166934
• MIM: 608283
• UniProt ID: Q7Z4S6