Recombinant Human KDM3B Protein, His-SUMO/MYC-tagged
Cat.No. : | KDM3B-1266H |
Product Overview : | Recombinant Human KDM3B protein (1498-1721aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 1498-1721 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAV NVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQG QENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSP EHVKHCFRLTQEFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | KDM3B lysine (K)-specific demethylase 3B [ Homo sapiens ] |
Official Symbol | KDM3B |
Synonyms | KDM3B; lysine (K)-specific demethylase 3B; C5orf7, chromosome 5 open reading frame 7 , JMJD1B, jumonji domain containing 1B; lysine-specific demethylase 3B; KIAA1082; NET22; nuclear protein 5qNCA; jumonji domain containing 1B; jumonji domain-containing protein 1B; jmjC domain-containing histone demethylation protein 2B; 5qNCA; C5orf7; JMJD1B |
Gene ID | 51780 |
mRNA Refseq | NM_016604 |
Protein Refseq | NP_057688 |
MIM | 609373 |
UniProt ID | Q7LBC6 |
◆ Recombinant Proteins | ||
CXCL8-349C | Active Recombinant Human CXCL8 Protein (8-79aa, 72 aa) | +Inquiry |
TNFRSF17-102H | Recombinant Human TNFRSF17 Protein, Fc-tagged | +Inquiry |
FGF19-906H | Recombinant Human FGF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
BLVRA-10242H | Recombinant Human BLVRA, GST-tagged | +Inquiry |
MFSD6B-1287Z | Recombinant Zebrafish MFSD6B | +Inquiry |
◆ Native Proteins | ||
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC25B-7665HCL | Recombinant Human CDC25B 293 Cell Lysate | +Inquiry |
CAMK2D-7878HCL | Recombinant Human CAMK2D 293 Cell Lysate | +Inquiry |
NMT1-3783HCL | Recombinant Human NMT1 293 Cell Lysate | +Inquiry |
MMP26-4274HCL | Recombinant Human MMP26 293 Cell Lysate | +Inquiry |
GANAB-6025HCL | Recombinant Human GANAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDM3B Products
Required fields are marked with *
My Review for All KDM3B Products
Required fields are marked with *
0
Inquiry Basket