Active Recombinant Human CXCL8 Protein (8-79aa, 72 aa)

• Cat.No.: CXCL8-349C
• Product Overview: Recombinant human I Interleukin-8/CXCL8 (rhIL-8) produced in E. coli is a single non-glycosylated polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhIL-8 has a molecular mass of 8.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 72
• Description: Interleukin-8 is one of the first discovered chemokines, and belongs to the CXCL family, in which the first two conserved cysteines are separated by one residue. In vivo, IL-8 exists in two forms: 77 a.a. produced by endothelial cells, and the more active 72 a.a. produced by monocytes. The receptors of IL-8 are the seven-helical G-protein coupled receptors CXCR1 and CXCR2, exclusively expressed on neutrophils. The functions of IL-8 are to induce rapid changes in cellular shape, activate the integrins, and release the granule contents of neutrophils. Thus, IL-8 can enhance the antimicrobial actions of defense cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 20 ng/mL, measured by the FLIPR assay using CHO cells transfected with human CXCR1, the receptor of human CXCL8, corresponding to a specific activity of > 5 × 10^4 units/mg.
• Molecular Mass: 8.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Interleukin-8/CXCL8 (rhIL-8) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-8 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ]
• Official Symbol: CXCL8
• Synonyms: CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
• Gene ID: 3576
• mRNA Refseq: NM_000584
• Protein Refseq: NP_000575
• MIM: 146930
• UniProt ID: P10145