Recombinant Human KDM3B Protein, His-SUMO/MYC-tagged

Cat.No. : KDM3B-1266H
Product Overview : Recombinant Human KDM3B protein (1498-1721aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1498-1721 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 45.6 kDa
AA Sequence : MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAV
NVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQG
QENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSP
EHVKHCFRLTQEFR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name KDM3B lysine (K)-specific demethylase 3B [ Homo sapiens ]
Official Symbol KDM3B
Synonyms KDM3B; lysine (K)-specific demethylase 3B; C5orf7, chromosome 5 open reading frame 7 , JMJD1B, jumonji domain containing 1B; lysine-specific demethylase 3B; KIAA1082; NET22; nuclear protein 5qNCA; jumonji domain containing 1B; jumonji domain-containing protein 1B; jmjC domain-containing histone demethylation protein 2B; 5qNCA; C5orf7; JMJD1B
Gene ID 51780
mRNA Refseq NM_016604
Protein Refseq NP_057688
MIM 609373
UniProt ID Q7LBC6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KDM3B Products

Required fields are marked with *

My Review for All KDM3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon