Recombinant Human KCNJ6 protein, His-tagged

Cat.No. : KCNJ6-6754H
Product Overview : Recombinant Human KCNJ6 protein(351-423 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 351-423 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name KCNJ6 potassium inwardly-rectifying channel, subfamily J, member 6 [ Homo sapiens ]
Official Symbol KCNJ6
Synonyms KCNJ6; potassium inwardly-rectifying channel, subfamily J, member 6; KCNJ7; G protein-activated inward rectifier potassium channel 2; BIR1; GIRK2; hiGIRK2; KATP2; Kir3.2; inward rectifier K(+) channel Kir3.2; inward rectifier potassium channel KIR3.2; potassium channel, inwardly rectifying subfamily J member 6; GIRK-2; KATP-2; KIR3.2; MGC126596;
mRNA Refseq NM_002240
Protein Refseq NP_002231
MIM 600877
UniProt ID P48051
Gene ID 3763

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KCNJ6 Products

Required fields are marked with *

My Review for All KCNJ6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon