Recombinant Full Length Mouse G Protein-Activated Inward Rectifier Potassium Channel 2(Kcnj6) Protein, His-Tagged
Cat.No. : | RFL36894MF |
Product Overview : | Recombinant Full Length Mouse G protein-activated inward rectifier potassium channel 2(Kcnj6) Protein (P48542) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR AKLIKSKQTSEGEFIPLNQSDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP KEELEIVVILEGIVEATGMTCQARSSYITSEILWGYRFTPVLTMEDGFYEVDYNSFHETY ETSTPSLSAKELAELANRAEVPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE NESKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj6 |
Synonyms | Kcnj6; Girk2; Kcnj7; W; G protein-activated inward rectifier potassium channel 2; GIRK-2; Inward rectifier K(+ channel Kir3.2; Potassium channel, inwardly rectifying subfamily J member 6 |
UniProt ID | P48542 |
◆ Recombinant Proteins | ||
RFL10803PF | Recombinant Full Length Pseudomonas Putida Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
Epha4-7439R | Active Recombinant Rat Epha4 protein, hFc-tagged | +Inquiry |
ATP2C1-268H | Recombinant Human ATP2C1 Protein, His-tagged | +Inquiry |
GAD2-13107H | Recombinant Human GAD2, GST-tagged | +Inquiry |
THY1-9788Z | Recombinant Zebrafish THY1 | +Inquiry |
◆ Native Proteins | ||
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
Complement C1s-44H | Native Human Complement C1s | +Inquiry |
C1-95H | Active Native Human C1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLA2-3054HCL | Recombinant Human POLA2 293 Cell Lysate | +Inquiry |
IGBP1-5269HCL | Recombinant Human IGBP1 293 Cell Lysate | +Inquiry |
TERF2-1146HCL | Recombinant Human TERF2 293 Cell Lysate | +Inquiry |
C18orf32-8220HCL | Recombinant Human C18orf32 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnj6 Products
Required fields are marked with *
My Review for All Kcnj6 Products
Required fields are marked with *
0
Inquiry Basket