Recombinant Human KCNIP1 protein, GST-tagged
Cat.No. : | KCNIP1-5643H |
Product Overview : | Recombinant Human KCNIP1 protein(1-216 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-216 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | KCNIP1 Kv channel interacting protein 1 [ Homo sapiens ] |
Official Symbol | KCNIP1 |
Synonyms | KCNIP1; Kv channel interacting protein 1; Kv channel-interacting protein 1; KCHIP1; vesicle APC-binding protein; potassium channel interacting protein 1; potassium channel-interacting protein 1; A-type potassium channel modulatory protein 1; VABP; MGC95; |
mRNA Refseq | NM_001034837 |
Protein Refseq | NP_001030009 |
MIM | 604660 |
UniProt ID | Q9NZI2 |
Gene ID | 30820 |
◆ Recombinant Proteins | ||
KCNIP1-8506M | Recombinant Mouse KCNIP1 Protein | +Inquiry |
KCNIP1-3225H | Recombinant Human KCNIP1 protein, His-tagged | +Inquiry |
KCNIP1-5643H | Recombinant Human KCNIP1 protein, GST-tagged | +Inquiry |
KCNIP1-28452TH | Recombinant Human KCNIP1, His-tagged | +Inquiry |
KCNIP1-2846R | Recombinant Rat KCNIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNIP1-5056HCL | Recombinant Human KCNIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNIP1 Products
Required fields are marked with *
My Review for All KCNIP1 Products
Required fields are marked with *
0
Inquiry Basket