Recombinant Human KCNIP1, His-tagged

• Cat.No.: KCNIP1-28452TH
• Product Overview: Recombinant fragment, corresponding to amino acids 15-214 of Human KCNIP1 Isoform 2 with an N-terminal His tag; MWt 23 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 15-214 a.a.
• Description: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
• Conjugation: HIS
• Tissue specificity: Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.
• Form: Lyophilised:Reconstitute with 82 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQ VLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAH YLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWT FNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKE DTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRS LQLFQN
• Sequence Similarities: Belongs to the recoverin family.Contains 4 EF-hand domains.

Gene Information

• Gene Name: KCNIP1 Kv channel interacting protein 1 [ Homo sapiens ]
• Official Symbol: KCNIP1
• Synonyms: KCNIP1; Kv channel interacting protein 1; Kv channel-interacting protein 1; KCHIP1
• Gene ID: 30820
• mRNA Refseq: NM_014592
• Protein Refseq: NP_055407
• MIM: 604660
• Uniprot ID: Q9NZI2
• Chromosome Location: 5q35
• Function: calcium ion binding; ion channel activity; potassium channel regulator activity; protein N-terminus binding; protein binding