Recombinant Human KAT7 Protein, GST-tagged

• Cat.No.: KAT7-5864H
• Product Overview: Human MYST2 full-length ORF ( NP_008998.1, 1 a.a. - 611 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. [provided by RefSeq, Oct 2016]
• Molecular Mass: 36.41 kDa
• AA Sequence: SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KAT7 lysine acetyltransferase 7 [ Homo sapiens (human) ]
• Official Symbol: KAT7
• Synonyms: KAT7; lysine acetyltransferase 7; HBO1; HBOA; MYST2; ZC2HC7; histone acetyltransferase KAT7; K(lysine) acetyltransferase 7; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2; MYST histone acetyltransferase 2; histone acetyltransferase MYST2; histone acetyltransferase binding to ORC1; EC 2.3.1.48
• Gene ID: 11143
• mRNA Refseq: NM_001199155
• Protein Refseq: NP_001186084
• MIM: 609880
• UniProt ID: O95251