Recombinant Human KAT6B Protein, GST-tagged

• Cat.No.: KAT6B-5867H
• Product Overview: Human MYST4 partial ORF ( NP_036462, 80 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]
• Molecular Mass: 35.97 kDa
• AA Sequence: FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KAT6B lysine acetyltransferase 6B [ Homo sapiens (human) ]
• Official Symbol: KAT6B
• Synonyms: KAT6B; lysine acetyltransferase 6B; qkf; MORF; MOZ2; GTPTS; MYST4; ZC2HC6B; querkopf; histone acetyltransferase KAT6B; K(lysine) acetyltransferase 6B; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4; MOZ-related factor; MYST histone acetyltransferase (monocytic leukemia) 4; MYST-4; histone acetyltransferase MORF; histone acetyltransferase MOZ2; histone acetyltransferase MYST4; monocytic leukemia zinc finger protein-related factor; EC 2.3.1.48
• Gene ID: 23522
• mRNA Refseq: NM_001256468
• Protein Refseq: NP_001243397
• MIM: 605880
• UniProt ID: Q8WYB5