Recombinant Human JPH1 protein, GST-tagged

• Cat.No.: JPH1-785H
• Product Overview: Recombinant Human JPH1 protein(NP_065698)(464-639 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 464-639 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: RSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: JPH1 junctophilin 1 [ Homo sapiens ]
• Official Symbol: JPH1
• Synonyms: JPH1; junctophilin 1; junctophilin-1; JP 1; mitsugumin72; junctophilin type1; junctophilin type 1; JP1; JP-1; DKFZp762L0313
• Gene ID: 56704
• mRNA Refseq: NM_020647
• Protein Refseq: NP_065698
• MIM: 605266
• UniProt ID: Q9HDC5