Recombinant Human IZUMO1R Protein, His/Avi tagged, Biotinylated

• Cat.No.: IZUMO1R-18H
• Product Overview: Biotinylated Recombinant Human IZUMO1R Protein with His/Avi tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Avi
• Description: Enables signaling receptor activity. Predicted to be involved in cell adhesion; fusion of sperm to egg plasma membrane involved in single fertilization; and sperm-egg recognition. Predicted to be located in extracellular region and plasma membrane. Predicted to be anchored component of external side of plasma membrane.
• Form: Liquid
• Molecular Mass: The protein has a calculated MW of 26 kDa.
• AA Sequence: GDKLLSVCMNSKRHKQEPGPEDELYQECRPWEDNACCTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGPWIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSEEKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWFEPTLSNPNVEVALHFAGGLNDIFEAQKIEWHEHHHHHH
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.38 mg/mL by BCA
• Storage Buffer: Liquid in sterile PBS, pH 7.4

Gene Information

• Gene Name: IZUMO1R IZUMO1 receptor, JUNO [ Homo sapiens (human) ]
• Official Symbol: IZUMO1R
• Synonyms: IZUMO1R; IZUMO1 receptor, JUNO; JUNO; FOLR4; Folbp3; FR-delta; sperm-egg fusion protein Juno; IZUMO1 receptor protein JUNO; IZUMO1 receptor, JUNO, FR-delta; folate receptor 4 (delta) homolog; folate receptor 4, delta (putative); folate receptor delta; probable folate receptor delta
• Gene ID: 390243
• mRNA Refseq: NM_001393610
• Protein Refseq: NP_001380539
• MIM: 615737
• UniProt ID: A6ND01