Recombinant Full Length Solanum Lycopersicum Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL36519SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum Cytochrome b559 subunit alpha(psbE) Protein (Q2MI83) (1-83aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-83) |
Form : | Lyophilized powder |
AA Sequence : | MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | Q2MI83 |
◆ Recombinant Proteins | ||
MPXV-0784 | Recombinant Monkeypox Virus Protein, MPXVgp136 | +Inquiry |
COL3A1-01H | Recombinant Human COL3A1 protein, His-tagged | +Inquiry |
UCHL1-392H | Recombinant Human UCHL1 protein, His-tagged | +Inquiry |
RFL20435RF | Recombinant Full Length Rat Transmembrane Protein 150A(Tmem150A) Protein, His-Tagged | +Inquiry |
SAP027A-011-2278S | Recombinant Staphylococcus aureus (strain: NE 3828) SAP027A_011 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8356H | Native Human CGA | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNH2-5059HCL | Recombinant Human KCNH2 293 Cell Lysate | +Inquiry |
Thyroid-658B | Bovine Thyroid Lysate, Total Protein | +Inquiry |
TMPRSS4-908HCL | Recombinant Human TMPRSS4 293 Cell Lysate | +Inquiry |
SELS-1983HCL | Recombinant Human SELS 293 Cell Lysate | +Inquiry |
OTP-3517HCL | Recombinant Human OTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket