Recombinant Human ITPKB Protein (442-946 aa), His-SUMO-tagged

• Cat.No.: ITPKB-591H
• Product Overview: Recombinant Human ITPKB Protein (442-946 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 442-946 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 72.5 kDa
• AA Sequence: RVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ITPKB inositol-trisphosphate 3-kinase B [ Homo sapiens ]
• Official Symbol: ITPKB
• Synonyms: ITPKB; IP3 3KB; IP3KB; IP3K B; IP3K; PIG37; IP3K-B; IP3-3KB
• Gene ID: 3707
• mRNA Refseq: NM_002221
• Protein Refseq: NP_002212
• MIM: 147522
• UniProt ID: P27987