Recombinant Human ITLN1 Protein, GST-tagged

Description :	ITLN1 (Intelectin 1) is a Protein Coding gene. Diseases associated with ITLN1 include Lipid-Rich Carcinoma and Obesity. Among its related pathways are Defensins and Innate Immune System. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ITLN2.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	61.4 kDa
AA Sequence :	MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ]
Official Symbol	ITLN1
Synonyms	ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin;
Gene ID	55600
mRNA Refseq	NM_017625
Protein Refseq	NP_060095
MIM	609873
UniProt ID	Q8WWA0