Recombinant Full Length Human ITLN1 Protein, GST-tagged

• Cat.No.: ITLN1-5815HF
• Product Overview: Human ITLN1 full-length ORF ( NP_060095.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ITLN1 (Intelectin 1) is a Protein Coding gene. Diseases associated with ITLN1 include Lipid-Rich Carcinoma and Obesity. Among its related pathways are Defensins and Innate Immune System. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ITLN2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.4 kDa
• Protein length: 313 amino acids
• AA Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ]
• Official Symbol: ITLN1
• Synonyms: ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin
• Gene ID: 55600
• mRNA Refseq: NM_017625
• Protein Refseq: NP_060095
• MIM: 609873
• UniProt ID: Q8WWA0