Recombinant Human ITLN1
Cat.No. : | ITLN1-29873TH |
Product Overview : | Recombinant Full Length Human ITLN1 produced in Saccharomyces cerevisiae; amino acids 1-313; 313 amino acids, MWt 32.9 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-313 a.a. |
Description : | Intelectin-1 also known as the intestinal lactoferrin receptor is a protein that in humans is encoded by the ITLN1 gene. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. |
Tissue specificity : | Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testi |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRS CKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGG WTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGN WANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKS PMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKY GEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFT AGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLL FYR |
Sequence Similarities : | Contains 1 fibrinogen C-terminal domain. |
Full Length : | Full L. |
Gene Name | ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ] |
Official Symbol | ITLN1 |
Synonyms | ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; |
Gene ID | 55600 |
mRNA Refseq | NM_017625 |
Protein Refseq | NP_060095 |
MIM | 609873 |
Uniprot ID | Q8WWA0 |
Chromosome Location | 1q21.3 |
Function | receptor binding; sugar binding; |
◆ Recombinant Proteins | ||
ITLN1-57H | Active Recombinant Human Omentin 1, FLAG-tagged | +Inquiry |
ITLN1-4958H | Recombinant Human ITLN1 Protein, GST-tagged | +Inquiry |
ITLN1-2176H | Recombinant Human Intelectin 1 (Galactofuranose Binding), FLAG-tagged | +Inquiry |
ITLN1-3692H | Recombinant Human PMP2, His-tagged | +Inquiry |
ITLN1-113H | Recombinant Human Intelectin 1 (galactofuranose binding) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITLN1 Products
Required fields are marked with *
My Review for All ITLN1 Products
Required fields are marked with *
0
Inquiry Basket