Recombinant Human ITLN1 Protein

• Cat.No.: ITLN1-197H
• Product Overview: Recombinant Human ITLN1 Protein without tag was expressed in E. coli.

Specification

• Description: Omentin is an adipokine that is produced and secreted by the small intestine, visceral adipose tissue, perivascular adipose tissue, and epicardial adipose tissue. Omentin enhances insulin-stimulated glucose uptake in adipocytes and is a link between obesity and Type 2 Diabetes. Omentin also functions as a vasodilator and plays a protective role during coronary atherosclerosis and hypertension.
• Source: E. coli
• Species: Human
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 35.0 kDa (313 amino acids)
• AA Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
• Endotoxin: ≤5 EUs/μg, Kinetic LAL
• Purity: ≥90%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 5: 1 mannitol to protein, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens (human) ]
• Official Symbol: ITLN1
• Synonyms: ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin
• Gene ID: 55600
• mRNA Refseq: NM_017625
• Protein Refseq: NP_060095
• MIM: 609873
• UniProt ID: Q8WWA0