Recombinant Human ITK protein, His-tagged

• Cat.No.: ITK-3745H
• Product Overview: Recombinant Human ITK protein(151-258 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-258 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ITK IL2-inducible T-cell kinase [ Homo sapiens ]
• Official Symbol: ITK
• Synonyms: ITK; IL2-inducible T-cell kinase; tyrosine-protein kinase ITK/TSK; EMT; LYK; PSCTK2; kinase EMT; T-cell-specific kinase; tyrosine-protein kinase LYK; IL-2-inducible T cell kinase; IL-2-inducible T-cell kinase; homolog of mouse T-cell itk/tsk; interleukin-2-inducible T cell kinase; interleukin-2-inducible T-cell kinase; MGC126257; MGC126258
• Gene ID: 3702
• mRNA Refseq: NM_005546
• Protein Refseq: NP_005537
• MIM: 186973
• UniProt ID: Q08881