Recombinant Human ITGB3 protein(631-700 aa), C-His-tagged

• Cat.No.: ITGB3-2555H
• Product Overview: Recombinant Human ITGB3 protein(P05106)(631-700 aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 631-700 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS

Gene Information

• Gene Name: ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ]
• Official Symbol: ITGB3
• Synonyms: ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2
• Gene ID: 3690
• mRNA Refseq: NM_000212
• Protein Refseq: NP_000203
• UniProt ID: P05106