Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged

• Cat.No.: ITGB2-2556H
• Product Overview: Recombinant Human ITGB2 protein(P05107)(451-520 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 451-520 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ]
• Official Symbol: ITGB2
• Synonyms: ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor); LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1
• Gene ID: 3689
• mRNA Refseq: NM_000211
• Protein Refseq: NP_000202
• MIM: 600065
• UniProt ID: P05107