Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged

Cat.No. : ITGB2-2556H
Product Overview : Recombinant Human ITGB2 protein(P05107)(451-520 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 451-520 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH
Gene Name ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ]
Official Symbol ITGB2
Synonyms ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor); LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1;
Gene ID 3689
mRNA Refseq NM_000211
Protein Refseq NP_000202
MIM 600065
UniProt ID P05107

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ITGB2 Products

Required fields are marked with *

My Review for All ITGB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon