Recombinant Human ITGAV protein

• Cat.No.: ITGAV-26862TH
• Product Overview: Recombinant Human ITGAV was expressed in Wheat Germ.

Specification

• Description: The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
• Source: Wheat Germ
• Species: Human
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 116 kDa
• AA Sequence: MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSQMFLLVGAPKANT TQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY DPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQV ELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIV SIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAML HLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNST LVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
• Applications: Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
• Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Tag: Non

Gene Information

• Gene Name: ITGAV integrin, alpha V [ Homo sapiens ]
• Official Symbol: ITGAV
• Synonyms: ITGAV; integrin, alpha V; antigen identified by monoclonal L230 , integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) , MSK8, vitronectin receptor , VNRA, VTNR; integrin alpha-V; CD51; integrin alphaVbeta3; vitronectin receptor subunit alpha; antigen identified by monoclonal L230; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); MSK8; VNRA; VTNR; DKFZp686A08142
• Gene ID: 3685
• mRNA Refseq: NM_002210
• Protein Refseq: NP_002201
• MIM: 193210
• UniProt ID: P06756
• Chromosome Location: 2q31-q32
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem
• Function: contributes_to insulin-like growth factor I binding; contributes_to opsonin binding; protein binding; protein kinase C alpha binding; contributes_to protein kinase C binding; receptor activity; transforming growth factor beta binding