Recombinant Human ITGA9 Protein, GST-tagged
Cat.No. : | ITGA9-4992H |
Product Overview : | Human ITGA9 partial ORF ( NP_002198, 785 a.a. - 886 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers. [provided by RefSeq |
Molecular Mass : | 36.96 kDa |
AA Sequence : | GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA9 integrin, alpha 9 [ Homo sapiens ] |
Official Symbol | ITGA9 |
Synonyms | ITGA9; integrin, alpha 9; integrin alpha-9; ALPHA RLC; integrin; alpha 4 like; ITGA4L; RLC; integrin alpha-RLC; ALPHA-RLC; |
Gene ID | 3680 |
mRNA Refseq | NM_002207 |
Protein Refseq | NP_002198 |
MIM | 603963 |
UniProt ID | Q13797 |
◆ Recombinant Proteins | ||
ITGA9-2077C | Recombinant Chicken ITGA9 | +Inquiry |
Itga9-248M | Recombinant Mouse Itga9 Protein, His/GST-tagged | +Inquiry |
ITGA9-176H | Recombinant Human ITGA9, His-tagged | +Inquiry |
ITGA9-247H | Recombinant Human ITGA9 Protein, His/GST-tagged | +Inquiry |
ITGA9-4992H | Recombinant Human ITGA9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA9-5130HCL | Recombinant Human ITGA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA9 Products
Required fields are marked with *
My Review for All ITGA9 Products
Required fields are marked with *
0
Inquiry Basket