Recombinant Human ITGA6, GST-tagged

• Cat.No.: ITGA6-4111H
• Product Overview: Recombinant Human ITGA6 (24 a.a. - 133 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 24 a.a. - 133 a.a.
• Description: The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 37.84 kDa
• AA Sequence: FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIE FDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
• Purification: Glutathione Sepharose 4 Fast Flow
• Applications: ELISA; WB; Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGA6 integrin, alpha 6 [ Homo sapiens (human) ]
• Official Symbol: ITGA6
• Synonyms: ITGA6; integrin, alpha 6; CD49f; VLA-6; ITGA6B; integrin alpha-6; integrin alpha6B; CD49 antigen-like family member F
• Gene ID: 3655
• mRNA Refseq: NM_000210
• Protein Refseq: NP_000201
• MIM: 147556
• UniProt ID: P23229
• Chromosome Location: 2q31.1
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway; Arf6 trafficking events; Arrhythmogenic right ventricular cardiomyopathy; Assembly of collagen fibrils and other multimeric structures
• Function: metal ion binding; protein binding