Recombinant Human ITGA4 Protein, GST-tagged

• Cat.No.: ITGA4-4997H
• Product Overview: Human ITGA4 partial ORF ( NP_000876, 98 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ]
• Official Symbol: ITGA4
• Synonyms: ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518
• Gene ID: 3676
• mRNA Refseq: NM_000885
• Protein Refseq: NP_000876
• MIM: 192975
• UniProt ID: P13612