Recombinant Human ITGA4 protein(376-558aa), His-GST-tagged
Cat.No. : | ITGA4-2321H |
Product Overview : | Recombinant Human ITGA4 protein(P13612)(376-558aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 376-558aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCR |
Gene Name | ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ] |
Official Symbol | ITGA4 |
Synonyms | ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518; |
Gene ID | 3676 |
mRNA Refseq | NM_000885 |
Protein Refseq | NP_000876 |
MIM | 192975 |
UniProt ID | P13612 |
◆ Recombinant Proteins | ||
Itga4-3595M | Recombinant Mouse Itga4 Protein, Myc/DDK-tagged | +Inquiry |
ITGA4-161H | Recombinant Human ITGA4 & ITGB1, Flag & His tagged | +Inquiry |
ITGA4-4998H | Recombinant Human ITGA4 Protein | +Inquiry |
ITGA4-4319H | Recombinant Human ITGA4 Protein (Met1-Thr977), C-His tagged | +Inquiry |
ITGA4-664HFL | Recombinant Full Length Human ITGA4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA4-5133HCL | Recombinant Human ITGA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA4 Products
Required fields are marked with *
My Review for All ITGA4 Products
Required fields are marked with *
0
Inquiry Basket