Recombinant Full Length Human ITGA4 Protein, C-Flag-tagged
Cat.No. : | ITGA4-664HFL |
Product Overview : | Recombinant Full Length Human ITGA4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 111.2 kDa |
AA Sequence : | MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVG APTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGS IVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDL IVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGK AYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAV MNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENG WPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTH QAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQPILQQKKEKDIMKKTINFARFCAHENCSAD LQVSAKIGFLKPHENKTYLAVGSMKTLMLNVSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEV TDNSGVVQLDCSIGYIYVDHLSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPL KYEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVQFLSKTDKRLLYCIKADPHCLNFLCNFGKMESG KEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVI ISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | ITGA4 integrin subunit alpha 4 [ Homo sapiens (human) ] |
Official Symbol | ITGA4 |
Synonyms | IA4; CD49D |
Gene ID | 3676 |
mRNA Refseq | NM_000885.6 |
Protein Refseq | NP_000876.3 |
MIM | 192975 |
UniProt ID | P13612 |
◆ Recombinant Proteins | ||
RFL16519MF | Recombinant Full Length Mouse Protein Jagunal Homolog 1(Jagn1) Protein, His-Tagged | +Inquiry |
MSRB1-3871C | Recombinant Chicken MSRB1 | +Inquiry |
MFGE8-220H | Recombinant Human MFGE8 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANXA5-26600TH | Recombinant Human ANXA5 protein, His-tagged | +Inquiry |
Trim33-6654M | Recombinant Mouse Trim33 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A40-1069HCL | Recombinant Human SLC25A40 cell lysate | +Inquiry |
Skin-56H | Human Skin Tissue Lysate | +Inquiry |
SMPD1-702HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
CCL3L1-7722HCL | Recombinant Human CCL3L1 293 Cell Lysate | +Inquiry |
CMTM2-7419HCL | Recombinant Human CMTM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA4 Products
Required fields are marked with *
My Review for All ITGA4 Products
Required fields are marked with *
0
Inquiry Basket