Recombinant Human ITGA2 Protein, GST-tagged

• Cat.No.: ITGA2-5000H
• Product Overview: Human ITGA2 partial ORF (NP_002194.2, 30 a.a. - 119 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.53 kDa
• AA Sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 30-119 a.a.

Gene Information

• Gene Name: ITGA2 integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) [ Homo sapiens ]
• Official Symbol: ITGA2
• Synonyms: ITGA2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); CD49B; integrin alpha-2; CD49b; integrin alpha 2; collagen receptor; VLA-2 subunit alpha; platelet antigen Br; platelet glycoprotein Ia; platelet glycoprotein GPIa; CD49 antigen-like family member B; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; BR; GPIa; VLA-2; VLAA2; BDPLT9
• Gene ID: 3673
• mRNA Refseq: NM_002203
• Protein Refseq: NP_002194
• MIM: 192974
• UniProt ID: P17301