Recombinant Human ITGA2 protein(711-790 aa), C-His-tagged

• Cat.No.: ITGA2-2671H
• Product Overview: Recombinant Human ITGA2 protein(P17301)(711-790 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 711-790 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ITGA2 integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) [ Homo sapiens ]
• Official Symbol: ITGA2
• Synonyms: ITGA2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); CD49B; integrin alpha-2; CD49b; integrin alpha 2; collagen receptor; VLA-2 subunit alpha; platelet antigen Br; platelet glycoprotein Ia; platelet glycoprotein GPIa; CD49 antigen-like family member B; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; BR; GPIa; VLA-2; VLAA2; BDPLT9
• Gene ID: 3673
• mRNA Refseq: NM_002203
• Protein Refseq: NP_002194
• MIM: 192974
• UniProt ID: P17301