Recombinant Human Isg15 protein, GST-tagged

Cat.No. : Isg15-3120H
Product Overview : Recombinant Human Isg15 protein(P05161)(2-157aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-157aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.3 kDa
AA Sequence : AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ]
Official Symbol Isg15
Synonyms ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP;
Gene ID 9636
mRNA Refseq NM_005101
Protein Refseq NP_005092
MIM 147571
UniProt ID P05161

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Isg15 Products

Required fields are marked with *

My Review for All Isg15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon