Recombinant Full Length Human ISG15 Protein, C-Flag-tagged
Cat.No. : | ISG15-931HFL |
Product Overview : | Recombinant Full Length Human ISG15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST VLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY GLKPLSTVFMNLRLRGGGTEPGGRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | ISG15 ISG15 ubiquitin like modifier [ Homo sapiens (human) ] |
Official Symbol | ISG15 |
Synonyms | G1P2; IP17; UCRP; IFI15; IMD38; hUCRP |
Gene ID | 9636 |
mRNA Refseq | NM_005101.4 |
Protein Refseq | NP_005092.1 |
MIM | 147571 |
UniProt ID | P05161 |
◆ Recombinant Proteins | ||
ISG15-3329H | Recombinant Human ISG15 Protein (Gly2-Gly157), C-His tagged | +Inquiry |
ISG15-242H | Recombinant Human ISG15 | +Inquiry |
ISG15-258H | Recombinant Human ISG15, StrepII-tagged | +Inquiry |
Isg15-83H | Recombinant Human Isg15 protein | +Inquiry |
Isg15-3120H | Recombinant Human Isg15 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *
0
Inquiry Basket