Recombinant Human IRS2 Protein, GST-tagged

• Cat.No.: IRS2-5029H
• Product Overview: Human IRS2 partial ORF ( NP_003740.2, 494 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstream effectors. The product of this gene is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation, as well as by an interleukin 4 receptor-associated kinase in response to IL4 treatment. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: DPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IRS2 insulin receptor substrate 2 [ Homo sapiens ]
• Official Symbol: IRS2
• Synonyms: IRS2; insulin receptor substrate 2; IRS-2
• Gene ID: 8660
• mRNA Refseq: NM_003749
• Protein Refseq: NP_003740
• MIM: 600797
• UniProt ID: Q9Y4H2