Recombinant Human IRGM protein, GST-tagged

• Cat.No.: IRGM-3118H
• Product Overview: Recombinant Human IRGM protein(A1A4Y4)(1-181aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-181aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.1 kDa
• AA Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IRGM immunity-related GTPase family, M [ Homo sapiens ]
• Official Symbol: IRGM
• Synonyms: IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264
• Gene ID: 345611
• mRNA Refseq: NM_001145805
• Protein Refseq: NP_001139277
• MIM: 608212
• UniProt ID: A1A4Y4