Recombinant Human IRAK4 Protein, His tagged

• Cat.No.: IRAK4-35H
• Product Overview: Recombinant Human IRAK4 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 125-460 aa
• Description: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: The protein has a calculated MW of 39 kDa.
• AA Sequence: MPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTASLEHHHHHH
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.17 mg/mL
• Storage Buffer: Sterile 50 mM Tris, 250 mM NaCl, pH7.8

Gene Information

• Gene Name: IRAK4 interleukin-1 receptor-associated kinase 4 [ Homo sapiens ]
• Official Symbol: IRAK4
• Synonyms: IRAK4; interleukin-1 receptor-associated kinase 4; NY REN 64; renal carcinoma antigen NY-REN-64; IPD1; REN64; IRAK-4; NY-REN-64
• Gene ID: 51135
• mRNA Refseq: NM_001114182
• Protein Refseq: NP_001107654
• MIM: 606883
• UniProt ID: Q9NWZ3