Recombinant Human IRAK1BP1, His-tagged
Cat.No. : | IRAK1BP1-27501TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-260 of Human IRAK1BP1 with N terminal His tag, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-260 a.a. |
Description : | IRAK1BP1 is a component of the IRAK1 dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHP LSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTK EAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVIS PPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVG QTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL |
Full Length : | Full L. |
Gene Name | IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens ] |
Official Symbol | IRAK1BP1 |
Synonyms | IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; |
Gene ID | 134728 |
mRNA Refseq | NM_001010844 |
Protein Refseq | NP_001010844 |
Uniprot ID | Q5VVH5 |
Chromosome Location | 6q14-q15 |
◆ Recombinant Proteins | ||
IRAK1BP1-2290R | Recombinant Rhesus monkey IRAK1BP1 Protein, His-tagged | +Inquiry |
IRAK1BP1-5304C | Recombinant Chicken IRAK1BP1 | +Inquiry |
IRAK1BP1-27501TH | Recombinant Human IRAK1BP1, His-tagged | +Inquiry |
Irak1bp1-3568M | Recombinant Mouse Irak1bp1 Protein, Myc/DDK-tagged | +Inquiry |
IRAK1BP1-1692H | Recombinant Human IRAK1BP1 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK1BP1-5172HCL | Recombinant Human IRAK1BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRAK1BP1 Products
Required fields are marked with *
My Review for All IRAK1BP1 Products
Required fields are marked with *
0
Inquiry Basket