Recombinant Human IRAK1BP1 Protein, GST-tagged

• Cat.No.: IRAK1BP1-5054H
• Product Overview: Human IRAK1BP1 full-length ORF ( NP_001010844.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: IRAK1BP1 (Interleukin 1 Receptor Associated Kinase 1 Binding Protein 1) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 55.5 kDa
• AA Sequence: MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens ]
• Official Symbol: IRAK1BP1
• Synonyms: IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460
• Gene ID: 134728
• mRNA Refseq: NM_001010844
• Protein Refseq: NP_001010844
• UniProt ID: Q5VVH5