Recombinant Full Length Human IRAK1BP1 Protein, GST-tagged

Cat.No. : IRAK1BP1-5728HF
Product Overview : Human IRAK1BP1 full-length ORF ( NP_001010844.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : IRAK1BP1 (Interleukin 1 Receptor Associated Kinase 1 Binding Protein 1) is a Protein Coding gene.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 55.5 kDa
Protein length : 260 amino acids
AA Sequence : MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens ]
Official Symbol IRAK1BP1
Synonyms IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460;
Gene ID 134728
mRNA Refseq NM_001010844
Protein Refseq NP_001010844
MIM 615375
UniProt ID Q5VVH5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IRAK1BP1 Products

Required fields are marked with *

My Review for All IRAK1BP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon