Recombinant Human IQ motif containing GTPase activating protein 2 Protein, His-tagged

• Cat.No.: IQGAP2-001H
• Product Overview: Recombinant Human IQGAP2 Protein (444-633aa) with C-His-tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 444-633aa
• Description: This gene encodes a member of the IQGAP family. The encoded protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. This protein interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. It also acts as a tumor suppressor and has been found to play a role in regulating innate antiviral responses. Alternative splicing results in multiple transcript variants.
• Tag: C-His
• Molecular Mass: 23 kDa
• AA Sequence: MNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAHAQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLYKESHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: IQGAP2 IQ motif containing GTPase activating protein 2 [Homo sapiens (human)]
• Official Symbol: IQGAP2
• Synonyms: IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2
• Gene ID: 10788
• mRNA Refseq: NM_006633
• Protein Refseq: NP_006624
• MIM: 605401
• UniProt ID: Q13576