Recombinant Human INSRR Protein, GST-tagged
Cat.No. : | INSRR-5090H |
Product Overview : | Human INSRR partial ORF ( NP_055030, 651 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | INSRR (Insulin Receptor Related Receptor) is a Protein Coding gene. Diseases associated with INSRR include Podoconiosis and Neurofibrosarcoma. Among its related pathways are GPCR Pathway and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is IGF1R. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INSRR insulin receptor-related receptor [ Homo sapiens ] |
Official Symbol | INSRR |
Synonyms | INSRR; insulin receptor-related receptor; insulin receptor-related protein; IRR; IR-related receptor; |
Gene ID | 3645 |
mRNA Refseq | NM_014215 |
Protein Refseq | NP_055030 |
MIM | 147671 |
UniProt ID | P14616 |
◆ Recombinant Proteins | ||
INSRR-334H | Recombinant Human Insulin Receptor-related Receptor, GST-tagged, Active | +Inquiry |
INSRR-26859TH | Recombinant Human INSRR | +Inquiry |
Insrr-3555M | Recombinant Mouse Insrr Protein, Myc/DDK-tagged | +Inquiry |
INSRR-3082R | Recombinant Rat INSRR Protein | +Inquiry |
INSRR-2738R | Recombinant Rat INSRR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSRR Products
Required fields are marked with *
My Review for All INSRR Products
Required fields are marked with *
0
Inquiry Basket