Recombinant Human INSL3 protein, His-tagged

• Cat.No.: INSL3-3601H
• Product Overview: Recombinant Human INSL3 protein(17-131 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 17-131 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: INSL3 insulin-like 3 (Leydig cell) [ Homo sapiens ]
• Official Symbol: INSL3
• Synonyms: INSL3; insulin-like 3 (Leydig cell); relaxin like factor , RLNL; insulin-like 3; MGC119818; MGC119819; RLF; ley-I-L; relaxin-like factor b; leydig insulin-like peptide; leydig insulin -like hormone; leydig insulin -like peptide; RLNL
• Gene ID: 3640
• mRNA Refseq: NM_005543
• Protein Refseq: NP_005534
• MIM: 146738
• UniProt ID: P51460