Recombinant Human INSIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: INSIG2-2114H
• Product Overview: INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.
• Molecular Mass: 24.8 kDa
• AA Sequence: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: INSIG2 insulin induced gene 2 [ Homo sapiens (human) ]
• Official Symbol: INSIG2
• Synonyms: INSIG2; insulin induced gene 2; INSIG-2; insulin-induced gene 2 protein; INSIG2 membrane protein; insulin induced protein 2
• Gene ID: 51141
• mRNA Refseq: NM_016133
• Protein Refseq: NP_057217
• MIM: 608660
• UniProt ID: Q9Y5U4