Recombinant Human INSIG2 Protein, GST-tagged

• Cat.No.: INSIG2-5098H
• Product Overview: Human INSIG2 full-length ORF ( AAH22475, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq
• Molecular Mass: 50.49 kDa
• AA Sequence: MAEGETEPPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQPLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAVYECKVIAEKSHQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INSIG2 insulin induced gene 2 [ Homo sapiens (human) ]
• Official Symbol: INSIG2
• Synonyms: INSIG2; insulin induced gene 2; INSIG-2; insulin-induced gene 2 protein; INSIG2 membrane protein; insulin induced protein 2
• Gene ID: 51141
• mRNA Refseq: NM_001321329
• Protein Refseq: NP_001308258
• MIM: 608660
• UniProt ID: Q9Y5U4