Recombinant Human INS therapeutic protein(Insulin glargine)
Cat.No. : | Insulin-P057H |
Product Overview : | Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 32aa |
Description : | After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 60.6 Kda |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | INS; ILPR; IRDN; IDDM2; Insulin glargine |
Gene Name | INS insulin [ Homo sapiens ] |
Official Symbol | INS |
Synonyms | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
Gene ID | 3630 |
mRNA Refseq | NM_000207 |
Protein Refseq | NP_000198 |
UniProt ID | P01308 |
Chromosome Location | 11p15.5 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
◆ Recombinant Proteins | ||
INS-560C | Recombinant Cattle INS protein, His & GST-tagged | +Inquiry |
INS-321H | Recombinant Human INS protein | +Inquiry |
INS-623CE | Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged | +Inquiry |
INS-369C | Recombinant Cynomolgus Monkey INS Protein, His (Fc)-Avi-tagged | +Inquiry |
INS-41P | Porcine Insulin | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket