Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged
Cat.No. : | INS-623CE |
Product Overview : | Recombinant Full Length Cynomolgus Monkey insulin Protein (25-110 aa) with His tag was expressed in E. coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-110 aa |
Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
Molecular Mass : | 10 kDa |
AA Sequence : | MHHHHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDPQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris-HCl, pH8.0, 200mM NaCl |
Concentration : | 0.16 mg/mL by BCA |
Gene Name | INS insulin [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | INS |
Synonyms | INS; insulin; preproinsulin |
Gene ID | 704534 |
mRNA Refseq | XM_028833049 |
Protein Refseq | XP_028688882 |
UniProt ID | F7AUL3 |
◆ Recombinant Proteins | ||
INS-0301H | Active Recombinant Human INS protein | +Inquiry |
INS-1135H | Recombinant Horse INS protein, GST-tagged | +Inquiry |
INS-321 | Synthesis Human Proinsulin C-Peptide (55-89), bioactive peptide hormone | +Inquiry |
INS-53H | Active Recombinant Human INS Protein | +Inquiry |
INS-191HFL | Active Recombinant Full Length Human INS Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
INS-512D | Native Bovine INS | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket