Recombinant Human INPPL1 Protein, GST-tagged
Cat.No. : | INPPL1-5101H |
Product Overview : | Human INPPL1 partial ORF ( NP_001558, 1159 a.a. - 1258 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an SH2-containing 5-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INPPL1 inositol polyphosphate phosphatase-like 1 [ Homo sapiens ] |
Official Symbol | INPPL1 |
Synonyms | INPPL1; inositol polyphosphate phosphatase-like 1; phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; 51C protein; SHIP2; SHIP-2; INPPL-1; protein 51C; SH2 domain-containing inositol 5-phosphatase 2; SH2 domain-containing inositol-5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2; |
Gene ID | 3636 |
mRNA Refseq | NM_001567 |
Protein Refseq | NP_001558 |
MIM | 600829 |
UniProt ID | O15357 |
◆ Recombinant Proteins | ||
INPPL1-3075R | Recombinant Rat INPPL1 Protein | +Inquiry |
INPPL1-8232M | Recombinant Mouse INPPL1 Protein | +Inquiry |
INPPL1-4559M | Recombinant Mouse INPPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
INPPL1-5101H | Recombinant Human INPPL1 Protein, GST-tagged | +Inquiry |
INPPL1-2099R | Recombinant Rhesus Macaque INPPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INPPL1 Products
Required fields are marked with *
My Review for All INPPL1 Products
Required fields are marked with *
0
Inquiry Basket