Recombinant Human INPP1, His-tagged

• Cat.No.: INPP1-117H
• Product Overview: Recombinant Human Inositol Polyphosphate 1-Phosphatase/INPP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Thr399) of Human INPP1 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-399 a.a.
• Description: Inositol Polyphosphate 1-Phosphatase (INPP1) is a member of the inositol monophosphatase family. INPP1 is widely expressed in tissues, with highest expression levels observed in the pancreas and kidney. INPP1 is inhibited by Li+. Removing the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. INPP1 is involved in signal transduction and phosphatidylinositol signaling pathway.
• AA Sequence: MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNM ENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVA FTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGV PLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSF SAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILR AMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQ NLAPAETHTVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: INPP1 inositol polyphosphate-1-phosphatase [ Homo sapiens ]
• Official Symbol: INPP1
• Synonyms: INPP1; inositol polyphosphate-1-phosphatase; inositol polyphosphate 1-phosphatase; IPP; IPPase; MGC110984
• Gene ID: 3628
• mRNA Refseq: NM_001128928
• Protein Refseq: NP_001122400
• MIM: 147263
• UniProt ID: P49441
• Chromosome Location: 2q32
• Pathway: D-myo-inositol (1,4,5)-trisphosphate degradation, organism-specific biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol, organism-specific biosystem
• Function: hydrolase activity; inositol-1,4-bisphosphate 1-phosphatase activity; metal ion binding