Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | INO80E-3547H |
Product Overview : | INO80E MS Standard C13 and N15-labeled recombinant protein (NP_775889) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | INO80E INO80 complex subunit E [ Homo sapiens (human) ] |
Official Symbol | INO80E |
Synonyms | INO80E; INO80 complex subunit E; CCDC95; INO80 complex subunit E; coiled-coil domain containing 95; coiled-coil domain-containing protein 95 |
Gene ID | 283899 |
mRNA Refseq | NM_173618 |
Protein Refseq | NP_775889 |
UniProt ID | Q8NBZ0 |
◆ Recombinant Proteins | ||
INO80E-5113H | Recombinant Human INO80E Protein, GST-tagged | +Inquiry |
INO80E-11668Z | Recombinant Zebrafish INO80E | +Inquiry |
INO80E-2095R | Recombinant Rhesus Macaque INO80E Protein, His (Fc)-Avi-tagged | +Inquiry |
Ino80e-3542M | Recombinant Mouse Ino80e Protein, Myc/DDK-tagged | +Inquiry |
INO80E-3547H | Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
INO80E-5201HCL | Recombinant Human INO80E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INO80E Products
Required fields are marked with *
My Review for All INO80E Products
Required fields are marked with *
0
Inquiry Basket