Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: INO80E-3547H
• Product Overview: INO80E MS Standard C13 and N15-labeled recombinant protein (NP_775889) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
• Molecular Mass: 26.5 kDa
• AA Sequence: MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: INO80E INO80 complex subunit E [ Homo sapiens (human) ]
• Official Symbol: INO80E
• Synonyms: INO80E; INO80 complex subunit E; CCDC95; INO80 complex subunit E; coiled-coil domain containing 95; coiled-coil domain-containing protein 95
• Gene ID: 283899
• mRNA Refseq: NM_173618
• Protein Refseq: NP_775889
• UniProt ID: Q8NBZ0