Recombinant Human INO80E Protein, GST-tagged

• Cat.No.: INO80E-5113H
• Product Overview: Human INO80E full-length ORF ( NP_775889.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: INO80E (INO80 Complex Subunit E) is a Protein Coding gene. Among its related pathways are Deubiquitination and Transcription-Coupled Nucleotide Excision Repair (TC-NER).
• Molecular Mass: 52.9 kDa
• AA Sequence: MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INO80E INO80 complex subunit E [ Homo sapiens ]
• Official Symbol: INO80E
• Synonyms: CCDC95; INO80E; INO80 complex subunit E
• Gene ID: 283899
• mRNA Refseq: NM_173618
• Protein Refseq: NP_775889
• UniProt ID: Q8NBZ0