Recombinant Full Length Human INO80E Protein, C-Myc/DDK-tagged

• Cat.No.: INO80E-12HFL
• Product Overview: Recombinant Full Length protein of human INO80 complex subunit E (INO80E) with a C-Myc/DDK tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
• Molecular Mass: 26.3 kDa
• AA Sequence: MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 μg/mL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Full Length: Full L.

Gene Information

• Gene Name: INO80E INO80 complex subunit E [ Homo sapiens (human) ]
• Official Symbol: INO80E
• Synonyms: INO80E; INO80 complex subunit E; CCDC95; INO80 complex subunit E; coiled-coil domain containing 95; coiled-coil domain-containing protein 95
• Gene ID: 283899
• mRNA Refseq: NM_173618.1
• Protein Refseq: NP_775889.1
• UniProt ID: Q8NBZ0